Skip to product information
1 of 1

Gene Bio Systems

Recombinant African swine fever virus Virus attachment protein p12 (Ken-110)

Recombinant African swine fever virus Virus attachment protein p12 (Ken-110)

SKU:CSB-CF315319AEB

Regular price £1,173.00 GBP
Regular price Sale price £1,173.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Pig/Kenya/KEN-50/1950) (ASFV)

Uniprot NO.:P0C9Y1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALDGSSGGGSNVETLLIVAIVVVIMAIMLYYFWWMPRQQQKKCSKAEECTCTNGSCSLK TS

Protein Names:Recommended name: Virus attachment protein p12 Alternative name(s): Protein p12

Gene Names:Ordered Locus Names:Ken-110

Expression Region:1-62

Sequence Info:full length protein

View full details