Gene Bio Systems
Recombinant African swine fever virus Uncharacterized protein F165R (War-056)
Recombinant African swine fever virus Uncharacterized protein F165R (War-056)
SKU:CSB-CF316390AEI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)
Uniprot NO.:P0CA69
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MANPNKRIMNKKSKQASISSILNFFFFYIMEYFVAVDNETSLGVFTSIEQCEETMKQYPG LHYVVFKYTCPADAENTDVVYLIPSLTLHTPMFVDHCPNRTKQARHVLKKINLVFEEESI ENWKVSVNTVFPHVHNRLSAPKLSIDEANEAVEKFLIQAGRLMSL
Protein Names:Recommended name: Uncharacterized protein F165R Short name= pF165R
Gene Names:Ordered Locus Names:War-056
Expression Region:1-165
Sequence Info:full length protein
