Skip to product information
1 of 1

Gene Bio Systems

Recombinant African swine fever virus Uncharacterized protein DP60R(BA71V-158)

Recombinant African swine fever virus Uncharacterized protein DP60R(BA71V-158)

SKU:CSB-CF734200AEJ

Regular price £1,169.00 GBP
Regular price Sale price £1,169.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

Uniprot NO.:Q65214

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSIWPPQKKVFTVGFITGGVTPVMVSFVWPAAQPQKKINYSRKKKYFRPRSFYKKNVSF

Protein Names:Recommended name: Uncharacterized protein DP60R

Gene Names:Ordered Locus Names:BA71V-158 ORF Names:DP60R

Expression Region:1-60

Sequence Info:full length protein

View full details