Skip to product information
1 of 1

Gene Bio Systems

Recombinant African swine fever virus Uncharacterized protein B117L(Ba71V-083)

Recombinant African swine fever virus Uncharacterized protein B117L(Ba71V-083)

SKU:CSB-CF737444AEJ

Regular price £1,195.00 GBP
Regular price Sale price £1,195.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)

Uniprot NO.:Q65172

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGYTIQLDKDGDYCWDEDPTHHDPYMQANATSHVATSYATTSHAAVAAPHAAAHHTFHEP FIKLNLTDKNIFNGLGFILIVIFIYLLLITLQQMLTRHIYNTVQHCVKAHLDSKNLQ

Protein Names:Recommended name: Uncharacterized protein B117L Short name= pB117L

Gene Names:Ordered Locus Names:Ba71V-083 ORF Names:B117L

Expression Region:1-117

Sequence Info:full length protein

View full details