Skip to product information
1 of 1

Gene Bio Systems

Recombinant African swine fever virus Transmembrane protein EP84R (Pret-066)

Recombinant African swine fever virus Transmembrane protein EP84R (Pret-066)

SKU:CSB-CF316518AYG

Regular price £1,171.00 GBP
Regular price Sale price £1,171.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)

Uniprot NO.:P0CAL6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPYARDITKFITATEPEVGLPLLALQRSKSIIGVILLVISLLFIFIGIIILSVSSYTTTG SIFVVLSLILGGGGFFLIYKDNS

Protein Names:Recommended name: Transmembrane protein EP84R Short name= pEP84R

Gene Names:Ordered Locus Names:Pret-066

Expression Region:1-83

Sequence Info:full length protein

View full details