Recombinant African swine fever virus  Major structural protein p17 (War-117)

Recombinant African swine fever virus Major structural protein p17 (War-117)

CSB-CF315475AEI
Regular price
£866.00 GBP
Sale price
£866.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:African swine fever virus (isolate Warthog/Namibia/Wart80/1980) (ASFV)

Uniprot NO.:P0C9Z0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDTETSPLLSHNLSTREGIKQSTQGLLAHTIAKYPGTTAILLGILILLVIILIIVAIVYY NRAVDCKSSMPKPPPSYYVQQPEPHHHFPVFFRKRKNSTSQQSHIPSDEQLAELAHS

Protein Names:Recommended name: Major structural protein p17

Gene Names:Ordered Locus Names:War-117

Expression Region:1-117

Sequence Info:full length protein

Your list is ready to share