Gene Bio Systems
Recombinant African swine fever virus Envelope protein p54 (Ken-138)
Recombinant African swine fever virus Envelope protein p54 (Ken-138)
SKU:CSB-CF315320AEB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:African swine fever virus (isolate Pig/Kenya/KEN-50/1950) (ASFV)
Uniprot NO.:P0C9Z8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDSEFFQPVYPRHYGECLSPTSTPSFFSTHMCTILVAIVVLIIIIIVLIYLFSSRKKKAA APAIEEEDIQFINPYQDQQWAGATPQPGTSKPAGATTGNVGKPITDRPATDRPVTNNPVT DRLIMATGGPAAASAPSAELYTTATTQNTASQTMPAVEALRQRSTYTHKDLENSL
Protein Names:Recommended name: Envelope protein p54
Gene Names:Ordered Locus Names:Ken-138
Expression Region:1-175
Sequence Info:full length protein
