Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aeromonas hydrophila subsp. hydrophila UPF0060 membrane protein AHA_2410 (AHA_2410)

Recombinant Aeromonas hydrophila subsp. hydrophila UPF0060 membrane protein AHA_2410 (AHA_2410)

SKU:CSB-CF370291AUH

Regular price £1,194.00 GBP
Regular price Sale price £1,194.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240)

Uniprot NO.:A0KKX4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGELKTMGLFLVTALAEILGCYLPYLWLTQGRSVWLLLPAGLSLMLFAWLLSLHPTAAGR VYAAYGGVYIFVAILWLWLVDGIRPSLWDLVGSLVALCGMAIIMFAPREA

Protein Names:Recommended name: UPF0060 membrane protein AHA_2410

Gene Names:Ordered Locus Names:AHA_2410

Expression Region:1-110

Sequence Info:full length protein

View full details