Gene Bio Systems
Recombinant Aeromonas hydrophila subsp. hydrophila Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)
Recombinant Aeromonas hydrophila subsp. hydrophila Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)
SKU:CSB-CF368476AUH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240)
Uniprot NO.:A0KK53
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRPALARRLLSGLGKLLLAALLSTIVSVALLRFIDPPMWTWRLERALFPPAKVAEVKHDW VPLEQISRELQLAVIAAEDQRFAEHNGFDMDAISSALKHNQHSERVRGASTLSQQTAKNL FMWSDRSFLRKGIEAWFTLLMELGWDKSRILEMYLNIVEFGPGIYGAEAAARHYFGKPAA RLTRYEASLLAAALPNPWRYRVKPPSPYVQQRSAWIRRQMGQLGQITLNKVHQAD
Protein Names:Recommended name: Monofunctional biosynthetic peptidoglycan transglycosylase Short name= Monofunctional TGase EC= 2.4.2.-
Gene Names:Name:mtgA Ordered Locus Names:AHA_2130
Expression Region:1-235
Sequence Info:full length protein
