Skip to product information
1 of 1

Gene Bio Systems

Recombinant Actinobacillus pleuropneumoniae serotype 7 Probable intracellular septation protein A (APP7_1027)

Recombinant Actinobacillus pleuropneumoniae serotype 7 Probable intracellular septation protein A (APP7_1027)

SKU:CSB-CF451391AXI

Regular price £1,257.00 GBP
Regular price Sale price £1,257.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Actinobacillus pleuropneumoniae serotype 7 (strain AP76)

Uniprot NO.:B3GXW4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQLLEFIPLILFFTVYKLYGVQQAAITLVIATVIQLIVLKVLYKKIEKSQWIMGIFVVF FGILTAYFNDLNFLKWKVTIINGLFAAVLLVSQFVFKKPIIQMLLGKELKLPTNVWNRLN LGWAGFFIICMLLNIVISYYFSDDVWATFKTFGFTGLSLIAAIATGVYLYPHLKNVENTN EQA

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:APP7_1027

Expression Region:1-183

Sequence Info:full length protein

View full details