Gene Bio Systems
Recombinant Actinidia deliciosa Bet v 1 related allergen(ypr-10)
Recombinant Actinidia deliciosa Bet v 1 related allergen(ypr-10)
SKU:CSB-EP2017AXF
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: D1YSM5
Gene Names: ypr-10
Organism: Actinidia deliciosa (Kiwi)
AA Sequence: MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVFESISYHIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPDC
Expression Region: 1-157aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 32.9 kDa
Alternative Name(s):
Relevance:
Reference: "Characterization of a bet v 1 homologous food allergen from green kiwi (A.deliciosa)."Oberhuber C., Bulley S., Beuning L., Crowhurst R., Gleave A., Janssen B., Klages K., Martinus R., Marsh K., MacRae E., McNeilage M., Newcomb R., Richardson A., Ross G., Schroeder R., Snowdn K., Walton E., Wu R., Yauk Y., Hoffmann-Sommergruber K.Submitted (JAN-2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
