Gene Bio Systems
Recombinant Acaryochloris marina ATP synthase subunit a 2(atpB2)
Recombinant Acaryochloris marina ATP synthase subunit a 2(atpB2)
SKU:CSB-CF427301AVV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Acaryochloris marina (strain MBIC 11017)
Uniprot NO.:A8ZNS1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHLTPDQTIFWQWGLFSLNATLIFTWLVMGVLVVGSWFVTRHLSASTQISRGQNLLEVIV LGIRDQIQEIIDQPADPYLPFIGTLFIFIALSNLLSVIPGYQPPTGSLSTTTALALCVFF AVPLYGVQKKGVRGYLQQYLQPNPIMLPFNIIGDFSRIVALAVRLFGNVMSGTMIVGILL SVAPLFFPVMMQVLGLLTGVIQAYIFAILAMVFIAAASQVDQHNYQTDSEVSHG
Protein Names:Recommended name: ATP synthase subunit a 2 Alternative name(s): ATP synthase F0 sector subunit a 2 F-ATPase subunit 6 2
Gene Names:Name:atpB2 Synonyms:atpI2 Ordered Locus Names:AM1_D0162
Expression Region:1-234
Sequence Info:full length protein
