Gene Bio Systems
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R302(MIMI_R302)
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R302(MIMI_R302)
SKU:CSB-CF725996ADAZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Acanthamoeba polyphaga mimivirus (APMV)
Uniprot NO.:Q5UPZ1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFFLTIYHLIYKYNPLIFAQIFIGCLMYFMLIIFVWKIIDPKCFSKYICYIIIFAIIDFV VCFKFIYVKKNSSVKKVHVVTIGQANVPIETSEISDNTDYKVTYDQVSCTIDSSNNVNNM FLTSDNPVECLDEISETSLTQDE
Protein Names:Recommended name: Uncharacterized protein R302
Gene Names:Ordered Locus Names:MIMI_R302
Expression Region:1-143
Sequence Info:full length protein
