GeneBio Systems
EXT Monoclonal Antibody,(for General Species)
EXT Monoclonal Antibody,(for General Species)
SKU:MAV768Ge21
Couldn't load pickup availability
Size: 100uL
Target Name: EXT
Target Full Name: Exenatide
Alternative Names: Byetta; Bydureon; Exendin-4
Lead time: 1-3 days
Reactivity Species: General Species
UniProt ID: P26349
Gene ID: -
Featured Series: Monoclonal Antibodies(Primary Abs)
Category type: Monoclonal Antibody
Conjugation: -
Concentration: 1mg/mL
Host: Mouse
Potency (Clone Number): C2
Ig Isotype: IgG2a Kappa
Conjugated Ab Catalog: -
Immunogen Catalog Number: CPV768Ge11
Immunogen Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Buffer: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol
State: Liquid
Purification: Protein A + Protein G affinity chromatography
Application: WB;IHC;ICC;IP
USAGE: Immunohistochemistry: 5-20µg/mL; Immunofluorescence:5-20µg/mL; Optimal working dilutions must be determined by end user.
Storage: Store at 2°C to 8°C for frequent use, -20°C for 12 months
Expiration: Stable for 12 months if correctly stored.
Reference: -
