Skip to product information
1 of 1

GeneBio Systems

Anti-SARS-CoV-2 NSP3 Antibody

Anti-SARS-CoV-2 NSP3 Antibody

SKU:A33999

Regular price £484.00 GBP
Regular price Sale price £484.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100 μg

Storage: Store at -20℃ for one year from date of receipt. After reconstitution, at 4℃ for one month. It can also be aliquotted and stored frozen at -20℃ for six months. Avoid repeated freeze-thaw cycles.

Form: Lyophilized

Reactivity: Human

Applications: ELISA

Application Details: ELISA, 0.001-0.1μg/ml, Human

Gene Name: rep

Specificity:

Background: Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2'-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.

Immunogen: HSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALK

Clonality: Polyclonal

Contents: Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Purification: Immunogen affinity purified.

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Reference: 1. Benedetti F, et al. J Transl Med, 2020 Aug 31. 2. Douangamath A, et al. Nat Commun, 2020 Oct 7. 3. Krafcikova P, et al. Nat Commun, 2020 Jul 24. 4. Rosas-Lemus M, et al. Sci Signal, 2020 Sep 29. 5. Vuong W, et al. Nat Commun, 2020 Aug 27.

Uniprot ID: P0DTC1/P0DTD1

Host: Rabbit

Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Conjugate:

Cross Reactivity:

Isotype: Rabbit IgG

Phospho_site:

Clone Number:

Observed Molecular Weight: 140 kDa, 130 kDa, 110 kDa

Calculated Molecular Weight: 16693 MW

Gene ID: 43740578

Protein Name: T-cell surface glycoprotein CD3 zeta chain

Gene Full Name: ORF1a polyprotein;ORF1ab polyprotein

Synonyms: Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp10; Non-structural protein 10; Growth factor-like peptide; GFL; rep

View full details