View larger

Recombinant Pyrobaculum aerophilum Cobalamin synthase(cobS)

CSB-CF820856FHU

Recombinant Pyrobaculum aerophilum Cobalamin synthase(cobS)

See below for Detailed Description

More details

CAD$1,571.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827)

Uniprot NO.:Q8ZZ89

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRCLKSLLAFFTAFPIGGAELSFKCVWALPYVAAPIIAAIPTTLLYLGASPAIAYIALLA ATGLHHLDGLADVGDALLVRDREAARRVLEDPRRGTGGIFAVTAVVVTTAAHLHSPLQLL LGEVFSKSTALLFAGFSKSFKPGLGEAFTEAAKRQWPAALPALAVLAYLAPVTTAVSLAT SALLYQLAYRHLGGANGDVYGYLLEVSRSAFVIWSAYVPVPTAF

Protein Names:Recommended name: Cobalamin synthase EC= 2.-.-.-

Gene Names:Name:cobS Ordered Locus Names:PAE0379

Expression Region:1-224

Sequence Info:full length protein

30 other products in the same category: