View larger

Recombinant Bradyrhizobium sp. ATP synthase subunit a 2(atpB2)

CSB-CF398977BPE

Recombinant Bradyrhizobium sp. ATP synthase subunit a 2(atpB2)

See below for Detailed Description

More details

CAD$1,570.00

More info

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)

Uniprot NO.:A5EBW8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQSSPLTSTLLFHIGPVAITRPVVTTWVIMAALALVCRFVTRRLAILPDGRQALLEGIVT SVAGQIEDVIRKDARPFLPLLGTLIIFLVVANLSGVLPGVEAPTSKIETPAALALIVFFS VHYFGVRERGLRGYLASFAEPKLIMLPLNILSEITRTFSLMVRLFGNIMSGEFIIGLVVA LAGLFVPIPLMALEILVGLVQAYIFTVLATVFIGAAVGSVAKG

Protein Names:Recommended name: ATP synthase subunit a 2 Alternative name(s): ATP synthase F0 sector subunit a 2 F-ATPase subunit 6 2

Gene Names:Name:atpB2 Ordered Locus Names:BBta_1436

Expression Region:1-223

Sequence Info:full length protein

30 other products in the same category: