Recombinant Macaca fascicularis Transthyretin(TTR)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Macaca fascicularis Transthyretin(TTR)

CSB-MP025270MOV
Regular price
$732.50 CAD
Sale price
$732.50 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug

Updated Date: Stock Protein updated on 20170725

Research areas: Cardiovascular

Target / Protein: TTR

Biologically active: Not Tested

Expression system: Mammalian cell

Species of origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Delivery time: 3-7 business days

Uniprot ID: Q8HXW1

AA Sequence: GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE

Tag info: N-terminal 6xHis-tagged

Expression Region: 21-147aa

Protein length: Full Length of Mature Protein

MW: 17.7 kDa

Alternative Name(s): Prealbumin

Relevance: Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).

Reference: "Isolation and characterization of cDNA for macaque neurological disease genes."Kusuda J., Osada N., Hida M., Sugano S., Hashimoto K. Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share