Recombinant  Uncharacterized protein ytcA(ytcA)

Recombinant Uncharacterized protein ytcA(ytcA)

CSB-CF855522EOD
Regular price
$1,404.00 CAD
Sale price
$1,404.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:Q8X2V8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CSLSPAIPVIGAYYPSWFFCAIASLILTLITRRVIQRANIKLAFVGIIYTALFALYAMLF WLAFF

Protein Names:Recommended name: Uncharacterized protein ytcA

Gene Names:Name:ytcA Ordered Locus Names:ECs5065

Expression Region:27-91

Sequence Info:full length protein

Your list is ready to share