
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: N/A
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Tyrophagus putrescentiae (Mold mite) (Acarus putrescentiae)
Delivery time: 3-7 business days
Uniprot ID: O02380
AA Sequence: GQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKLLATGEHGVLACGAVNTDVKP
Tag info: N-terminal 6xHis-tagged
Expression Region: 16-141aa
Protein length: Full Length of Mature Protein
MW: 17.3 kDa
Alternative Name(s): Allergen: Typ p 2
Relevance:
Reference: "Cloning and characterisation of a group II allergen from the dust mite Tyrophagus putrescentiae." Eriksson T.L.J., Johansson E., Whitley P., Schmidt M., Elsayed S., van Hage-Hamsten M. Eur. J. Biochem. 251:443-447(1998)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.