Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Enterotoxin type C-2(entC2)

Recombinant Staphylococcus aureus Enterotoxin type C-2(entC2)

SKU:CSB-EP339410FKZe1

Regular price $1,141.10 CAD
Regular price Sale price $1,141.10 CAD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P34071

Gene Names: entC2

Organism: Staphylococcus aureus

AA Sequence: ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG

Expression Region: 28-266aa

Sequence Info: Full Length

Source: E.coli

Tag Info: NO-tagged

MW: 27.6 kDa

Alternative Name(s): SEC2

Relevance: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.

Reference: "Conservation of the biologically active portions of staphylococcal enterotoxins C1 and C2." Bohach G.A., Schlievert P.M. Infect. Immun. 57:2249-2252(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details