Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: B0BNN3
Gene Names: Ca1
Organism: Rattus norvegicus (Rat)
AA Sequence: ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF
Expression Region: 2-261aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 32.2 kDa
Alternative Name(s): Carbonate dehydratase I
Relevance: Reversible hydration of carbon dioxide.
Reference: Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Proteome profile of the mature rat olfactory bulb.Maurya D.K., Sundaram C.S., Bhargava P.Proteomics 9:2593-2599(2009)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.