Recombinant Phleum pratense Pollen allergen Phl p 5a

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Phleum pratense Pollen allergen Phl p 5a

CSB-EP669216EUQb3
Regular price
$1,332.50 CAD
Sale price
$1,332.50 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Immunology

Uniprot ID: Q40962

Gene Names: N/A

Organism: Phleum pratense (Common timothy)

AA Sequence: ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV

Expression Region: 1-286aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 48.5 kDa

Alternative Name(s):

Relevance: Allergen Phl p Va Allergen: Phl p 5a

Reference: "Major allergen Phl p Va (timothy grass) bears at least two different IgE-reactive epitopes." Bufe A., Becker W.M., Schramm G., Petersen A., Mamat U., Schlaak M. J. Allergy Clin. Immunol. 94:173-181(1994)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share