
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: Q920H1
Gene Names: Scgb3a2
Organism: Mus musculus (Mouse)
AA Sequence: LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL
Expression Region: 22-139aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 15.2 kDa
Alternative Name(s): Pneumo secretory protein 1 Short name: PnSP-1 Uteroglobin-related protein 1
Relevance:
Reference: "UGRP1, a uteroglobin/Clara cell secretory protein-related protein, is a novel lung-enriched downstream target gene for the T/EBP/NKX2.1 homeodomain transcription factor."Niimi T., Keck-Waggoner C.L., Popescu N.C., Zhou Y., Levitt R.C., Kimura S.Mol. Endocrinol. 15:2021-2036(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.