Recombinant Mouse H-2 class II histocompatibility antigen gamma chain(Cd74) ,partial

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain(Cd74) ,partial

CSB-EP004956MO
Regular price
$1,133.75 CAD
Sale price
$1,133.75 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: Cd74

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P04441

AA Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL

Tag info: N-terminal 6xHis-tagged

Expression Region: 56-279aa

Protein length: Extracellular Domain

MW: 29.4 kDa

Alternative Name(s): Ia antigen-associated invariant chain ;IiMHC class II-associated invariant chain; CD74

Relevance: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.

Reference: The phagosomal proteome in interferon-gamma-activated macrophages.Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.Immunity 30:143-154(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share