Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P17515
Gene Names: Cxcl10
Organism: Mus musculus (Mouse)
AA Sequence: IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
Expression Region: 22-98aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 35.7 kDa
Alternative Name(s): 10KDA interferon gamma-induced protein Short name: Gamma-IP10 Short name: IP-10
Relevance: In addition to its role as a proinflammatory cytokine, may participate in T-cell effector function and perhaps T-cell development.
Reference: "Structure of mouse IP-10, a chemokine."Jabeen T., Leonard P., Jamaluddin H., Acharya K.R.Acta Crystallogr. D 64:611-619(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.