
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Uniprot NO.:O32866
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAIVLIDPESQIAMDAVTGAVAEWSEDVVTLDVMPLYEKVEELEQYVNDMMRAMDPSTTT WGTLPGREGVHETAGFLTNFAHGFVIGTMIVALVAFTLAAVYKLHALRLLGL
Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit B EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B
Gene Names:Name:mtrB Ordered Locus Names:MK0659
Expression Region:1-112
Sequence Info:full length protein