Recombinant Methanocaldococcus jannaschii  Uncharacterized protein MJ1580(MJ1580)

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1580(MJ1580)

CSB-CF688339MRU
Regular price
$1,466.00 CAD
Sale price
$1,466.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Uniprot NO.:Q58975

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLIKILEEKLMELIQIVGVIFALFALSRVVLQLKRRSISFNEGLFWIFVWGFVVIFLVFP EFFGYVAEVLGVGRGVDALIYISIVVLFYLIYRLYAKINNLERQITHIVREIAIRDRYEP KKRD

Protein Names:Recommended name: Uncharacterized protein MJ1580

Gene Names:Ordered Locus Names:MJ1580

Expression Region:1-124

Sequence Info:full length protein

Your list is ready to share