Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: D9IAI3
Gene Names: S1
Organism: Infectious bronchitis virus
AA Sequence: LACQYNTGNFSDGFYPFTNVSLVKERFVVYRETSVNTTLVLTNFTFTNVSNASPNTGGVNTINIYQTQTAQSGYYNFNFSFLSSFVYKQSDFMYGSYHPKCDFRPETINNGLWFNSLSVSLAYGPLQGGCKQSVFSNRATCCYAYSYNGPRLCKGVYIGELPQYFECGLLVYVIKSDGSRIQTRNEPLVLTHYNYNNITLDRCVEYNIYGRSGQGFIINVTASAANYNYLADGGLAILDTSGAIDIFVVQGEYGPNYYKVNPCEDVNQQFVVSGGGIVGVLTSHNETGSQQLENRFYVKLTNSTRRTRRL
Expression Region: 230-539aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 61.7 kDa
Alternative Name(s):
Relevance:
Reference: Characterization of a live attenuated infectious bronchitis virus vaccine candidate derived from the Israeli isolate IS/1494/06.Meir R., Simanov L.
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.