Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Signal Transduction
Uniprot ID: P08100
Gene Names: ARHGEF18
Organism: Homo sapiens (Human)
AA Sequence: MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQ
Expression Region: 1-36aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 20.2 kDa
Alternative Name(s): Opsin-2
Relevance: Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change leading to G-protein activation and release of all-trans retinal.
Reference: "Isolation and nucleotide sequence of the gene encoding human rhodopsin."Nathans J., Hogness D.S.Proc. Natl. Acad. Sci. U.S.A. 81:4851-4855(1984)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.