Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Nucleolin(NCL),Partial

Recombinant Human Nucleolin(NCL),Partial

SKU:CSB-YP015535HU

Regular price $1,108.80 CAD
Regular price Sale price $1,108.80 CAD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Epigenetics and Nuclear Signaling

Target / Protein: NCL

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P19338

AA Sequence: VKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWS

Tag info: N-terminal 6xHis-tagged

Expression Region: 2-482aa

Protein length: Partial

MW: 54.4 kDa

Alternative Name(s):

Relevance:

Reference: "Stress-dependent nucleolin mobilization mediated by p53-nucleolin complex formation."Daniely Y., Dimitrova D.D., Borowiec J.A. Mol. Cell. Biol. 22:6014-6022(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details