Recombinant Human KeRatin, type I cytoskeletal 10(KRT10),partial

Recombinant Human KeRatin, type I cytoskeletal 10(KRT10),partial

CSB-YP012504HU1
Regular price
$791.85 CAD
Sale price
$791.85 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Signal Transduction

Uniprot ID: P13645

Gene Names: KRT10

Organism: Homo sapiens (Human)

AA Sequence: EQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLE

Expression Region: 326-443aa

Sequence Info: Partial

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 15.7 kDa

Alternative Name(s): Cytokeratin-10 ;CK-10Keratin-10 ;K10

Relevance:

Reference: The complete sequence of the human intermediate filament chain keratin 10. Subdomainal divisions and model for folding of end domain sequences.Zhou X.M., Idler W.W., Steven A.C., Roop D.R., Steinert P.M.J. Biol. Chem. 263:15584-15589(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share