Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O95661
Gene Names: DIRAS3
Organism: Homo sapiens (Human)
AA Sequence: MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKC
Expression Region: 1-229aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 52.5 kDa
Alternative Name(s): Distinct subgroup of the Ras family member 3 Rho-related GTP-binding protein RhoI
Relevance:
Reference: "NOEY2 (ARHI), an imprinted putative tumor suppressor gene in ovarian and breast carcinomas." Yu Y.H., Xu F.J., Peng H., Fang X., Zhao S., Li Y., Cuevas B., Kuo W.-L., Gray J.W., Siciliano M., Mills G.B., Bast R.C. Jr. Proc. Natl. Acad. Sci. U.S.A. 96:214-219(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.