Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial(COX7A2L)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Cytochrome c oxidase subunit 7A-related protein, mitochondrial(COX7A2L)

CSB-EP005862HU
Regular price
$1,133.75 CAD
Sale price
$1,133.75 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: O14548

Gene Names: COX7A2L

Organism: Homo sapiens (Human)

AA Sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK

Expression Region: 1-114aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39.6 kDa

Alternative Name(s): COX7a-related protein Cytochrome c oxidase subunit VIIa-related protein EB1

Relevance: Involved in the regulation of oxidative phosphorylation and energy metabolism. Necessary for the assembly of mitochondrial respiratory supercomplex

Reference: "Isolation of estrogen-responsive genes with a CpG island library." Watanabe T., Inoue S., Hiroi H., Orimo A., Kawashima H., Muramatsu M. Mol. Cell. Biol. 18:442-449(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share