
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: O15467
Gene Names: CCL16
Organism: Homo sapiens (Human)
AA Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Expression Region: 24-120aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 27.2 kDa
Alternative Name(s): Chemokine CC-4 ;HCC-4;Chemokine LEC;IL-10-inducible chemokine;LCC-1;Liver-expressed chemokineLymphocyte and monocyte chemoattractant ;LMCMonotactin-1 ;MTN-1NCC-4;Small-inducible cytokine A16
Relevance: Shows chotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.
Reference: Genomic organization of the genes for human and mouse CC chemokine LEC.Fukuda S., Hanano Y., Iio M., Miura R., Yoshie O., Nomiyama H.DNA Cell Biol. 18:275-283(1999)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.