Recombinant Geobacter sulfurreducens  NADH-quinone oxidoreductase subunit A 1(nuoA1)

Recombinant Geobacter sulfurreducens NADH-quinone oxidoreductase subunit A 1(nuoA1)

CSB-CF748273GBK
Regular price
$1,460.00 CAD
Sale price
$1,460.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)

Uniprot NO.:Q74GA8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLGVYLPIIVLVAVAVIFGLASLTFSSLIGQKKPSAVKLAPYECGCEPVGSARERFSVKF YIIAMLFILFDIEAVFMYPWSVLFKRLGIFGVVEMGLFIVILFVGYIYVWKKGALEWE

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A 1 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A 1 NDH-1 subunit A 1 NUO1 1

Gene Names:Name:nuoA1 Ordered Locus Names:GSU0338

Expression Region:1-118

Sequence Info:full length protein

Your list is ready to share