Recombinant F1 capsule antigen(caf1)

Recombinant F1 capsule antigen(caf1)

CSB-YP338792YAS
Regular price
$1,169.57 CAD
Sale price
$1,169.57 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P26948

Gene Names: caf1

Organism: Yersinia pestis

AA Sequence: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ

Expression Region: 22-170aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 17.6 kDa

Alternative Name(s):

Relevance:

Reference: "Resolving the energy paradox of chaperone/usher-mediated fibre assembly." Zavialov A.V., Tischenko V.M., Fooks L.J., Brandsdal B.O., Aqvist J., Zav'yalov V.P., Macintyre S., Knight S.D. Biochem. J. 389:685-694(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share