Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)
Uniprot NO.:P0C6Z4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SSPTNAAAASLTEAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCF NKFVNTLLTD
Protein Names:Recommended name: Glycoprotein N Short name= gN
Gene Names:Name:GN ORF Names:BLRF1
Expression Region:33-102
Sequence Info:full length protein