Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P0C088
Gene Names: N/A
Organism: Artemisia vulgaris (Mugwort)
AA Sequence: ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND
Expression Region: 1-37aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: NO-Tagged
MW: 3.8 kDa
Alternative Name(s): Pollen allergen Art v 3 Allergen: Art v 3
Relevance: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues
Reference: "Lipid-transfer proteins as potential plant panallergens: cross-reactivity among proteins of Artemisia pollen, Castanea nut and Rosaceae fruits, with different IgE-binding capacities." Diaz-Perales A., Lombardero M., Sanchez-Monge R., Garcia-Selles F.J., Pernas M., Fernandez-Rivas M., Barber D., Salcedo G. Clin. Exp. Allergy 30:1403-1410(2000)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.