
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Actinobacillus succinogenes (strain ATCC 55618 / 130Z)
Uniprot NO.:A6VQC0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MINTNPKRSNEPPVWLLFSAGGMISALAFPVLILILGILLPLGIISPDGIIAFAHHWFGK LVILVLTIFPAWAGLHRIHHGMHDIKVHVPSGGLIFYGLAVLYTVVAIWGVASI
Protein Names:Recommended name: Fumarate reductase subunit D
Gene Names:Name:frdD Ordered Locus Names:Asuc_1816
Expression Region:1-114
Sequence Info:full length protein