
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: F8UNN7
Gene Names: NDM-1
Organism: Acinetobacter baumannii
AA Sequence: AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG
Expression Region: 164-222aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 22 kDa
Alternative Name(s):
Relevance:
Reference: MoMolecular characteristics and epidemiology of a novel sequence type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Molecular characteristics and Epidemiology of Novel Sequence Type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Complete sequence of the blaNDM-1-carrying plasmid pNDM-AB from Acinetobacter baumannii of food animal origin.Zhang W.J., Lu Z., Schwarz S., Zhang R.M., Wang X.M., Si W., Yu S., Chen L., Liu S.J. Antimicrob. Chemother. 68:1681-1682(2013)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.