Recombinant Acinetobacter baumannii Beta-lactamase(NDM-1),partial

Recombinant Acinetobacter baumannii Beta-lactamase(NDM-1),partial

CSB-RP076174Ba
Regular price
$1,066.00 CAD
Sale price
$1,066.00 CAD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: F8UNN7

Gene Names: NDM-1

Organism: Acinetobacter baumannii

AA Sequence: AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG

Expression Region: 164-222aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 22 kDa

Alternative Name(s):

Relevance:

Reference: MoMolecular characteristics and epidemiology of a novel sequence type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Molecular characteristics and Epidemiology of Novel Sequence Type 435 Acinetobacter baumannii harbored blaNDM-1, blaIMP-1, blaOXA-23-like, tetA and tetB in China.Cao J., Liu J., Wu Q., Shu H., Zhang X., Li X., Bao Q., Zhou T. Complete sequence of the blaNDM-1-carrying plasmid pNDM-AB from Acinetobacter baumannii of food animal origin.Zhang W.J., Lu Z., Schwarz S., Zhang R.M., Wang X.M., Si W., Yu S., Chen L., Liu S.J. Antimicrob. Chemother. 68:1681-1682(2013)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share