Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0382 inner membrane protein ygdD(ygdD)

Recombinant UPF0382 inner membrane protein ygdD(ygdD)

SKU:CSB-CF365021SZB

Regular price ¥263,400 JPY
Regular price Sale price ¥263,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shigella flexneri

Uniprot NO.:P0ADR5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSRFMLIFAAISGFIFVALGAFGAHVLSKTMGAVEMGWIQTGLEYQAFHTLAILGLAVA MQRRISIWFYWSSVFLALGTVLFSGSLYCLALSHLRLWAFVTPVGGVSFLAGWALMLVGA IRLKRKGVSHE

Protein Names:Recommended name: UPF0382 inner membrane protein ygdD

Gene Names:Name:ygdD Ordered Locus Names:SF2821, S3016

Expression Region:1-131

Sequence Info:full length protein

View full details