Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase(pat)

Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase(pat)

CSB-EP701139FOQ
Regular price
¥123,200 JPY
Sale price
¥123,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: pat

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Streptomyces viridochromogenes

Delivery time: 3-7 business days

Uniprot ID: Q57146

AA Sequence: MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-183aa

Protein length: Full Length

MW: 36.6 kDa

Alternative Name(s): Phosphinothricin-resistance protein

Relevance: Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance.

Reference: "Cloning of a phosphinothricin N-acetyltransferase gene from Streptomyces viridochromogenes Tue494 and its expression in Streptomyces lividans and Escherichia coli."Strauch E., Wohlleben W., Puehler A.Gene 63:65-74(1988)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share