Recombinant Schizosaccharomyces pombe  Vacuolar transporter chaperone 1(nrf1)

Recombinant Schizosaccharomyces pombe Vacuolar transporter chaperone 1(nrf1)

CSB-CF891472SXV
Regular price
¥169,200 JPY
Sale price
¥169,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q9UR17

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTQPLLQTTPGKRIALPVRVEPKVFFANERTFLSWLSFAVVLGGLSVGLLNFGDRIGKI SAGLFTIVAIGTMGYALGIYHWRASAIRRRGSGPYDDRLGPTILCFVLLAAIITNFVLRM LF

Protein Names:Recommended name: Vacuolar transporter chaperone 1 Alternative name(s): Negative regulator of cdc42

Gene Names:Name:nrf1 Synonyms:vtc1 ORF Names:SPBC21B10.04c

Expression Region:1-122

Sequence Info:full length protein

Your list is ready to share