Recombinant Saccharomyces cerevisiae  Mitochondrial import inner membrane translocase subunit TIM23(TIM23)

Recombinant Saccharomyces cerevisiae Mitochondrial import inner membrane translocase subunit TIM23(TIM23)

CSB-CF023553SVG
Regular price
¥179,000 JPY
Sale price
¥179,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P32897

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSWLFGDKTPTDDANAAVGGQDTTKPKELSLKQSLGFEPNINNIISGPGGMHVDTARLHP LAGLDKGVEYLDLEEEQLSSLEGSQGLIPSRGWTDDLCYGTGAVYLLGLGIGGFSGMMQG LQNIPPNSPGKLQLNTVLNHITKRGPFLGNNAGILALSYNIINSTIDALRGKHDTAGSIG AGALTGALFKSSKGLKPMGYSSAMVAAACAVWCSVKKRLLEK

Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit TIM23 Alternative name(s): Membrane import machinery protein MIM23 Mitochondrial protein import protein 3 Mitochondrial protein import protein MAS6

Gene Names:Name:TIM23 Synonyms:MAS6, MIM23, MPI3 Ordered Locus Names:YNR017W ORF Names:N3180

Expression Region:1-222

Sequence Info:full length protein

Your list is ready to share