Recombinant Rhizobium leguminosarum bv. viciae  Glycerol-3-phosphate acyltransferase 2(plsY2)

Recombinant Rhizobium leguminosarum bv. viciae Glycerol-3-phosphate acyltransferase 2(plsY2)

CSB-CF629837RKS
Regular price
¥178,700 JPY
Sale price
¥178,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium leguminosarum bv. viciae (strain 3841)

Uniprot NO.:Q1MGK1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVFWIAGAVGLAIAYLLGSTPSGYLAGKLIRGIDIREHGSKSTGATNVLRTLGKWPALVV LLVDVLKGVGAVVFARWFYSWFSTLSSGMPPTALDLQSLEPWAVCLTGLAVLLGHGRSVW LNFTGGKSVAAGLGVLLAMSWPVGLGAAMVFGVALAISRIVSLSSMLAALTAIALVCGLE QPLPYRLLVIAGGIYVIARHRTNIRRLLAGTEPRLGKVA

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 2 Alternative name(s): Acyl-PO4 G3P acyltransferase 2 Acyl-phosphate--glycerol-3-phosphate acyltransferase 2 G3P acyltransferase 2 Short name= GPAT 2 EC= 2.3.1.n3 Lys

Gene Names:Name:plsY2 Ordered Locus Names:RL2428

Expression Region:1-219

Sequence Info:full length protein

Your list is ready to share