Recombinant Rhizobium leguminosarum bv. viciae  Glycerol-3-phosphate acyltransferase 1(plsY1)

Recombinant Rhizobium leguminosarum bv. viciae Glycerol-3-phosphate acyltransferase 1(plsY1)

CSB-CF629846RKS
Regular price
¥177,000 JPY
Sale price
¥177,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium leguminosarum bv. viciae (strain 3841)

Uniprot NO.:Q1MIH8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLSNLMSWQITLPIALAAAIIGYLFGSIPFGLILTRAAGLGDVRSIGSGNIGATNVLRTG NRTLAAATLLLDALKASAAAWVVSYFLGEEAAIIAGFFAFIGHLFPVWIGFKGGKGVATY IGTLLGVAPIMVVLFAAVWLAVAFTTRYSSLSALVAMLVIPVALWILGNEKVAAVMAIMT LISYWKHKANISRLMGGTESKIGAKG

Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 1 Alternative name(s): Acyl-PO4 G3P acyltransferase 1 Acyl-phosphate--glycerol-3-phosphate acyltransferase 1 G3P acyltransferase 1 Short name= GPAT 1 EC= 2.3.1.n3 Lys

Gene Names:Name:plsY1 Ordered Locus Names:RL1737

Expression Region:1-206

Sequence Info:full length protein

Your list is ready to share