Recombinant Prochlorococcus marinus  Protein CrcB homolog 1(crcB1)

Recombinant Prochlorococcus marinus Protein CrcB homolog 1(crcB1)

CSB-CF653123PAAN
Regular price
¥169,200 JPY
Sale price
¥169,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Prochlorococcus marinus (strain MIT 9312)

Uniprot NO.:Q318B0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKIKIYIYILLACYIASFLRLFINNNFIVSIIGSLLFGFFIDKRLSYSIEKIILSGFFSC FTSFSGFIYFLYKVFNQGDLMKFIIFCNLIIIINLLVMYFGFWISRKIT

Protein Names:Recommended name: Protein CrcB homolog 1

Gene Names:Name:crcB1 Ordered Locus Names:PMT9312_1725, PMT9312_1724

Expression Region:1-109

Sequence Info:full length protein

Your list is ready to share