Recombinant Methanosarcina acetivorans  Protein CrcB homolog 3(crcB3)

Recombinant Methanosarcina acetivorans Protein CrcB homolog 3(crcB3)

CSB-CF855103MFB
Regular price
¥169,600 JPY
Sale price
¥169,600 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

Uniprot NO.:Q8TIQ3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIGTGGFIGASLRYTISSRVPKIQNIPAGTLTVNLLGSIVLALLTFSSEPESVVYLVNIG MLGSFTTFSTFAYETFRLLEDGQNISFFLNIFLNVMLCLLGVSIAYLALML

Protein Names:Recommended name: Protein CrcB homolog 3

Gene Names:Name:crcB3 Ordered Locus Names:MA_4089

Expression Region:1-111

Sequence Info:full length protein

Your list is ready to share