Recombinant Malus domestica Major allergen Mal d 1(MALD1)

Recombinant Malus domestica Major allergen Mal d 1(MALD1)

CSB-EP331771MPS
Regular price
¥127,000 JPY
Sale price
¥127,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Allergen

Target / Protein: MALD1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Malus domestica (Apple) (Pyrus malus)

Delivery time: 3-7 business days

Uniprot ID: P43211

AA Sequence: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-159aa

Protein length: Full Length

MW: 33.5 kDa

Alternative Name(s): Allergen Mal d I Allergen: Mal d 1

Relevance:

Reference: "Characterization of the 18-kDa apple allergen by two-dimensional immunoblotting and microsequencing."Vieths S., Schoening B., Petersen A.Int. Arch. Allergy Immunol. 104:399-404(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share